SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000035838 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000035838
Domain Number 1 Region: 144-442
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.08e-77
Family Transglutaminase core 0.00000185
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 7e-43
Family Transglutaminase N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 551-649
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.59e-28
Family Transglutaminase, two C-terminal domains 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000035838   Gene: ENSBTAG00000011439   Transcript: ENSBTAT00000035972
Sequence length 655
Comment pep:known_by_projection chromosome:UMD3.1:10:38519703:38538816:-1 gene:ENSBTAG00000011439 transcript:ENSBTAT00000035972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLGIKSCDFQAARNNAEHHTNDISSQRLFVRRGQPFTISLHFQAPVHTFLRALKKVA
LIAQTGKQPSKANGTQATFSVSSLGDRKWWSAMVEERDDQSWTISVTTPADAIIGHYSLL
LQISGRKQCLGQFTLLFNPWNREDAVFLGNEAQRKEYLLNQNGLIFLGTADCIQAEPWDF
GQLEEDVIDLGLSLLTVDNQVEKWGNPVHVARVLGALLHILKEKSVLPTAKIQTTEERAL
LNKRRGSAPILRQWVTGHGRPVYEGQAWVLAAVACTVLRGLGIPARVVTTFTSAQGTGGD
LLVNEYYNEEGLQNGEDNRGRAWIFQTSTECWMARPDLLEVYDGWQILYPSALKGGEVLE
ACDLVPVRAVKEGIVWLTPAASDIFASINASCVVWKCGEDGTLELTDSNTKYFGNNISTK
NVDCDCHEDITQNYKYPEGIRQCKESAHQCRRCQFYPWVRKIPWSRKWQHTHFLAQKNPM
GMRHLSGFSEALTLGSHVLHLLRVSAKKISTSLFNSNFEQSLPENSFLRLTAMATHSSLP
CFAQQDIAIRRPHLAIEMPETAEQHQTLIALVSIHNPLDVPLEDCVISIFGKGLIHREKS
YRVNSVQPRNTLRTQLKFVPMKVGCQRLTVEMDCNMFQNLTNFRTVMVVAPKSPA
Download sequence
Identical sequences E1BG43
ENSBTAP00000035838 ENSBTAP00000035838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]