SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036015 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036015
Domain Number 1 Region: 54-108,170-313
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-42
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 6-75,106-126
Classification Level Classification E-value
Superfamily EF-hand 0.0000000206
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036015   Gene: ENSBTAG00000025622   Transcript: ENSBTAT00000036152
Sequence length 631
Comment pep:known chromosome:UMD3.1:23:9237764:9263820:1 gene:ENSBTAG00000025622 transcript:ENSBTAT00000036152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYQVDSNGNSMLSNQDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVGLGELEELLAQEAQAAQSSGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSCLCYFGSEECKEKRGMIPLDAQCCVEVLPDREGKRCMFCVKTASRTYEMSASDTRQR
QEWTAAIQTAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEEMLRLQQLQEEKERK
LQELELLQEAQRQAERLMQEEEERRRSQHRELQQALEVQLREAEQARASMQAEMELKKEE
AARQRQRIKELEEMQQRLQEALQLEVKARQDEEAVRLAQTRLLEEEEEKLKQLLQLKEEQ
ERYIERAQQEKQELQQEMALQSRSLQQAQQQLEEVRQNRQRADEDVEAAQQKLRQASTNV
KHWNVQMNRLMHPIKPGDKRPTTSSSFTGFQAPLLARRDSSLKRLTRWGSRDNKTPSPSS
SDQQKSLNGGEDASSSASASQEDKLDLAPEN
Download sequence
Identical sequences A5PK34 L8I4Z3
ENSBTAP00000036015 NP_001092464.1.59421 NP_001092464.1.76553 XP_005903713.1.15283 9913.ENSBTAP00000036015 ENSBTAP00000036015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]