SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036380 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036380
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily EF-hand 2.8e-36
Family Calmodulin-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036380   Gene: ENSBTAG00000025822   Transcript: ENSBTAT00000036523
Sequence length 153
Comment pep:known chromosome:UMD3.1:10:15009940:15019251:-1 gene:ENSBTAG00000025822 transcript:ENSBTAT00000036523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLTVMRCLGASPTPGEAQRHLQTHRIDR
NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMQLGEKLTHK
EVEDLFREAGIEPNGKVKYDEFIQKLTIPVRDY
Download sequence
Identical sequences Q3T0E8
ENSBTAP00000036380 NP_001029843.1.59421 NP_001029843.1.76553 ENSBTAP00000036380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]