SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036408 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036408
Domain Number 1 Region: 44-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-82
Family Eukaryotic proteases 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036408   Gene: ENSBTAG00000013977   Transcript: ENSBTAT00000036551
Sequence length 327
Comment pep:known_by_projection chromosome:UMD3.1:7:3165640:3197445:-1 gene:ENSBTAG00000013977 transcript:ENSBTAT00000036551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALTGPHPGPVESWPTTPSLFLLLFLLPPTQVEATAHRHPASEEVAFSRDVACGQRHVQG
KILGGVDALEGKWPWQASVHFVGFHICGGSIIDEYWILSAAHCFDRNRNTEAFDMYVGLV
DLNVAGNHTQWFEVNRVIIHPTYELYHPVGGDIALVQLKTRIVFSDSVLPICIAPPDLTL
WNLSCWATGWGSISRKGDTSNKLQEVQLPLVPFHLCRLLYGQTDILPDMLCAGNFKDMKT
ACEGDSGGPLVCEFDRTWVQIGVVSWGQGCAYPMYPTVFARVSFFSKWIHHHIENTPLPL
QPLPALSSTLGAIISVLMTSLAAPSML
Download sequence
Identical sequences F1MEA3
ENSBTAP00000036408 ENSBTAP00000036408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]