SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036518 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036518
Domain Number 1 Region: 493-831
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.71e-111
Family PDEase 0.000000303
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-33
Family GAF domain 0.00038
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-29
Family GAF domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036518   Gene: ENSBTAG00000012945   Transcript: ENSBTAT00000036662
Sequence length 859
Comment pep:known_by_projection chromosome:UMD3.1:7:63190542:63267311:-1 gene:ENSBTAG00000012945 transcript:ENSBTAT00000036662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNVSFAKQYYNLRYRAKVISDLLGPREAAVDFSNYHALNSVEESEI
IFDLLRDFQDNLQAEKCVFNVMKKLCFLLQADRMSLFMYRARNGIAELATRLFNVHKDAV
LEECLVAPDSEIVFPLDMGVVGHVALSKKIVNVPNTEEDEHFCDFVDTLTEYQTKNILAS
PIMNGKDVVAIIMVVNKVDGPHFTENDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYAGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPSEDFFAFQKEPLDESGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLAQFLGWSVLNPDTYELMNKLENRKDIFQDMVKYHVKCDNEEIQTILKTREVYGKEPW
ECEEEELAEILQGELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYETQQEWTQYMMLDQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYETKMKGLEEEKQKQQAANQAAAGS
QHGGKQPGGGPASKSCCVQ
Download sequence
Identical sequences E1BK80
ENSBTAP00000036518 ENSBTAP00000036518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]