SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036550 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036550
Domain Number 1 Region: 396-578
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 2 Region: 556-655
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000000000238
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Domain Number 3 Region: 724-849
Classification Level Classification E-value
Superfamily EF-hand 0.000000147
Family Calmodulin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036550   Gene: ENSBTAG00000025898   Transcript: ENSBTAT00000036694
Sequence length 1070
Comment pep:known_by_projection chromosome:UMD3.1:11:6009139:6070490:-1 gene:ENSBTAG00000025898 transcript:ENSBTAT00000036694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GATLEEINQHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKALIAEETSSRLAEQEEEPEK
FREALVKFEARFNFPEAEKLITYYSCCCWKGRVPRQGWLYLSINHLCFYSFFLGKELKLV
IPWVDVQRLERTSNVFLTDTIRITTQNKERDFSMFLNLDEVFKIMEQLADVTLRRLLDNE
GFDLDPGLQEPSQITKRDLEARAQNEFFRAFFRLPRREKLHAVLDCSLWTPFSRCHTAGQ
MFTSDSYICFASKEAGCCKVILPLREVVSIEKMEDTSLLPNPIIVSIRSKMAFQFIELRD
RDSLVEGLLARLKLVHADHPVHYDTTLDEELTSPVFHSTSLCSGSHRFGGLEMVSSQNSE
EREKETSPRMHPEAFRQSGSQSPDSGLSREQIKVSLWNDHFVEYGRTVCMFRTEKIRKLV
AMGIPESLRGRLWLLFSVTCKSPDAVTDLAAHPGYYGNLVEESMGKCCLVTEEIERDLHR
SLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQQSMNILTSVLLLYAKEEEAFWLLVA
VCERMLPDYFNHRVIGAQVDQSVFEELIKEQLPELAEHMHDLSALASISLSWFLTLFLSI
MPLESAVNVVDCFFYDGIKAIFQLGLAVLEATAEGLCSSKDDSQAFMVLSRFLDHVKNED
SPGPPIGSHHAFFSDDQEPCPVTDIADLIRDSYEKFGDQSVAQIEHMRCRHRIRVLQGHE
DTTKQNVLRVVIPEVSVLPEDLEELYDLFKREHMMSCYWEQPRPMAPRHDPSRPYAEQYR
IDAQQFARLFQLVSPWTCGAHTEILAERTFRLLDENMDHLIEFKAFVSCLDIMYNGEMNE
KIKLLYRLHIPPALTENDRDSQSPLKNPLLSTSRPLVFGKSNGDTIDYQKQLKQMIKDLA
KEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGS
SSGSGSQEGGEELQASAPSPSSEQDLVFAETDTGQSPQASQAFPEEAQGDWTVSLEHILA
SLLTEQSLVNFFEKPLDIKSKLENAKLNQYSLKTCEMSRQSQPELKLSSP
Download sequence
Identical sequences F1N7K9
ENSBTAP00000036550 ENSBTAP00000036550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]