SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036577 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036577
Domain Number 1 Region: 167-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.71e-84
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily SEA domain 2.09e-26
Family SEA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036577   Gene: ENSBTAG00000025920   Transcript: ENSBTAT00000036722
Sequence length 417
Comment pep:known chromosome:UMD3.1:6:85410241:85452310:-1 gene:ENSBTAG00000025920 transcript:ENSBTAT00000036722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQPSILGRRTHSLKPWMIALIITAVVLVLAVIIGLPVYFLVFDQKVHYYQTSFQIPSIE
YNLDFSVEHSKNRTDLKQKISSEIDEIFQRSSLNRHYIKSHVFNVRPSNNGLKINVLLKF
QFTSNNADTIKREADSILHQKLKLNESFLKIDTSLPYLKAMNNVQAEHILNSCCGLGREF
PSMERIAYGNVAKKADWPWQASLQVDGIHFCGATLISEVWLLTAAHCFDSYKNPKRWTAS
FGTTLSPALMRQEVQSVVIHEDYASHKHDDDIALVKLSAPVIFSDEVHRVCLPDATFEAL
PESKVFVTGWGALKANGPFPNTLREVEVEIISNDICNQIHVYGGAVSSGMICAGFLKGKL
DACEGDSGGPLVIPRDGNIWYLIGIVSWGMDCGKENKPGVYTKVTRYRDWIKSKTDI
Download sequence
Identical sequences E1BJM8
ENSBTAP00000036577 9913.ENSBTAP00000036577 ENSBTAP00000036577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]