SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000036974 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000036974
Domain Number 1 Region: 151-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.03e-93
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 620-885
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.65e-36
Family DNA/RNA non-specific endonuclease 0.0084
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000562
Family Somatomedin B domain 0.0016
Further Details:      
 
Domain Number 4 Region: 105-145
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000034
Family Somatomedin B domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000036974   Gene: ENSBTAG00000013165   Transcript: ENSBTAT00000037135
Sequence length 888
Comment pep:known chromosome:UMD3.1:14:83360211:83456674:-1 gene:ENSBTAG00000013165 transcript:ENSBTAT00000037135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRRSCQLHQVISLFTFAVGVNICLGVTANRIKRAEGWGEGPPTVLSDSPSINISGSCK
GRCFELQEAGPPDCRCDNLCKSYSSCCLDFDELCLKTAGGWECTKDRCGEVRNEDHACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
HFNLRGREKFNHRWWGGQPLWITATKQGVIAGTFFWPVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLRDIDKTVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDIILVPGTLGRIRPKFNNHAKYDPKVIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDVHLLVERRWHVARKPLEVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTVPEEVTRPNYPGVMYLQSDFDLGCTCDDKAEPKNKLDELNKHLHIKESTEAETRKFR
GSKNEIKENVNGNFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYT
VSKQADVSDIPAHLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYGFLFPPYLSSSPEAKYD
AFLVTNMVPMYPAFKRIWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTQDKIKQ
YVEGSSVPVPTHYYSILTSCLDFTQPADRCDGPLSVSAFVLPHRPDNDESCNSSEDESKW
VEELLKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLQTYESEI
Download sequence
Identical sequences A1A4K5
ENSBTAP00000036974 NP_001073762.1.59421 NP_001073762.1.76553 ENSBTAP00000036974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]