SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037104 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037104
Domain Number 1 Region: 23-165
Classification Level Classification E-value
Superfamily EF-hand 3.18e-34
Family Calmodulin-like 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037104   Gene: ENSBTAG00000026273   Transcript: ENSBTAT00000037268
Sequence length 169
Comment pep:known_by_projection chromosome:UMD3.1:25:35734571:35743074:1 gene:ENSBTAG00000026273 transcript:ENSBTAT00000037268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQAPRRARKKAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAAPGC
RINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKAD
FIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Download sequence
Identical sequences F1MTS0
ENSBTAP00000037104 ENSBTAP00000037104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]