SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037156 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037156
Domain Number 1 Region: 36-178
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-39
Family SH2 domain 0.00000275
Further Details:      
 
Domain Number 2 Region: 147-236
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-19
Family Protein kinases, catalytic subunit 0.00000486
Further Details:      
 
Domain Number 3 Region: 8-45
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000291
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037156   Gene: ENSBTAG00000007932   Transcript: ENSBTAT00000037322
Sequence length 276
Comment pep:known_by_projection chromosome:UMD3.1:13:62128733:62140119:1 gene:ENSBTAG00000007932 transcript:ENSBTAT00000037322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTLLRSGEWWRARSLATRKEGYIPSNYVARVNSLETEEWFFKGISRKDAERQLLAPGN
VLGSFMIRDSETTKGSYSLSVRDYDPQHRDTVKHYKIRTLDNGGFYISPRSTFGSLQELV
AHYKKASDGLCQKLTVPCMSSKPQKPWEKDAWEIPRESLKMEKKLGAGQFGEVWMATYNK
HTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGATCW
ELGYQLCLLLVTCRVRVDSDMVLCPSRCPQPGQELF
Download sequence
Identical sequences F1MTD8
NP_001032218.2.59421 NP_001032218.2.76553 XP_005887967.1.15283 ENSBTAP00000037156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]