SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037246 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037246
Domain Number 1 Region: 15-286
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-88
Family Eukaryotic proteases 0.0000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037246   Gene: ENSBTAG00000016973   Transcript: ENSBTAT00000037413
Sequence length 343
Comment pep:known_by_projection chromosome:UMD3.1:25:27485086:27489416:-1 gene:ENSBTAG00000016973 transcript:ENSBTAT00000037413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKSGLGPRWLEAVATVLLLGLFRNGIGAVAAEADSCGMVPQGRITGGTTAALGQWPWQ
VSINHHGTHVCGGSLVSDQWVLSAAHCFPSDNKIEEYEVKLGAHQLDYFSTDTQVRGVAQ
VISHEKYSHEGSMGDIALLQLSSSVTFSRYIRPICLPAANASFPNGLQCVVTGWGHVAPS
VSLQHPRPLQQLEVPLISRETCNCLYNINAKPGEPHVIDQDMLCAGYVNGSKDACQGDSG
GPLSCPVAGRWYLAGIVSWGDACGAPNRPGVYTLTSVYASWIHYKVAELQPKVVPQMEES
QPDGHLCSHYKGFNSAPAQGLVGPILLLPLGLTLGLLRPLHED
Download sequence
Identical sequences F1MUB9
ENSBTAP00000037246 ENSBTAP00000037246 XP_019843388.1.53367 9913.ENSBTAP00000037246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]