SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037374 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037374
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.99e-49
Family Globins 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037374   Gene: ENSBTAG00000026418   Transcript: ENSBTAT00000037545
Sequence length 142
Comment pep:known chromosome:UMD3.1:25:210952:211719:1 gene:ENSBTAG00000026418 transcript:ENSBTAT00000037545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTP
AVHASLDKFLANVSTVLTSKYR
Download sequence
Identical sequences A0A1K0FUD3 P01966
ENSBTAP00000022034 ENSBTAP00000037374 9913.ENSBTAP00000022034 9913.ENSBTAP00000037374 NP_001070890.2.59421 NP_001070890.2.76553 XP_001788728.1.59421 XP_003585623.1.76553 XP_019843811.1.53367 ENSBTAP00000022034 ENSBTAP00000037374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]