SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037887 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037887
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-81
Family Protein kinases, catalytic subunit 0.000000000213
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-39
Family SH2 domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 51-173
Classification Level Classification E-value
Superfamily SH3-domain 1.27e-23
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037887   Gene: ENSBTAG00000012695   Transcript: ENSBTAT00000038070
Sequence length 509
Comment pep:known chromosome:UMD3.1:2:122092889:122113823:-1 gene:ENSBTAG00000012695 transcript:ENSBTAT00000038070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKTTLPMRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKTLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQTQGEVVKH
YKIRNLDKGGFYISPRVTFPGLHELVRHYMNTSDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTSEGIKLTINKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSHSLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMMLCWKER
PEERPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences Q3ZCM0
NP_001029506.1.59421 NP_001029506.1.76553 XP_005906266.1.15283 XP_010835212.1.44457 XP_019834692.1.53367 9913.ENSBTAP00000037887 ENSBTAP00000037887 ENSBTAP00000037887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]