SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000037916 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000037916
Domain Number 1 Region: 117-193,242-393
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.64e-28
Family Eukaryotic proteases 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000037916   Gene: ENSBTAG00000026708   Transcript: ENSBTAT00000038100
Sequence length 412
Comment pep:known chromosome:UMD3.1:9:23710554:23729764:1 gene:ENSBTAG00000026708 transcript:ENSBTAT00000038100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMFFGLMLFTLGWTLIDGSESEQDFMWHVRKIPRLVSERTFHLTSPAFEADAKMVLNR
VCGIECQKDLPAPSLSDLEDSLSYETVFENGSRTLTRVKVQGWVPEPTQNLTSQGAPVRR
KRQVYGTDSRFSILDKKFLTNFPFNTAVKLSTGCSGILISPNHVLTAAHCVHDGNGYIKG
SKKLRVGLLKMRNKGGGKRRRGSRRNRREVSGAGREGSQDSLKETAKAGRRRKGSARRQR
AADGRPSFQWTRVKNTHIPKGWARGESRDPALDYDYALLELKRPHKKKYMELGVSPTIKK
LPGGMIHFSGFDQDRADQLVYRFCSVSDESNDLLYQYCDAESGSTGSGVYLRLKEPDKKR
WKRKIIAIYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWMHGDDANCTQG
Download sequence
Identical sequences Q5E9X7
XP_005210754.1.76553 ENSBTAP00000037916 ENSBTAP00000037916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]