SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039011 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039011
Domain Number 1 Region: 24-227
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-41
Family Eukaryotic proteases 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039011   Gene: ENSBTAG00000027341   Transcript: ENSBTAT00000039211
Sequence length 230
Comment pep:known chromosome:UMD3.1:4:105920605:105940414:1 gene:ENSBTAG00000027341 transcript:ENSBTAT00000039211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITGVISVFVEDTADLNNLFYLLYLKSSYKSCMGTLIAPQWVITAAHCFLPDLQVILTGG
ATTFQELIGEILPYEEVIIHPNFTFTSPKNDLMLIKLSVPLTFFSTSMFQLPVSNSSDIA
DCLVYTWVEDKRSFGNRRGYLQSFMTELSTDLVCRTLLHKKFFEDVFCVGHLRKNTDECQ
VTTAAPATCGNKLQGIMSWTTGCFLTDHSAVFTNIYSHIPWIKSIISTNS
Download sequence
Identical sequences F1MQL3
ENSBTAP00000039011 ENSBTAP00000039011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]