SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039032 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039032
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.22e-70
Family Eukaryotic proteases 0.0000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039032   Gene: ENSBTAG00000021616   Transcript: ENSBTAT00000039232
Sequence length 279
Comment pep:known_by_projection chromosome:UMD3.1:7:44904216:44909195:-1 gene:ENSBTAG00000021616 transcript:ENSBTAT00000039232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVGDWGRLLLTVTAVLTLPMRPPGSWGAQIIGGHEVTPHSRPYMASVKFQGQHHCGG
FLLRARWVVSAAHCFSGRDPGTGLVVLGAHALRTKEATQQVFSISAVITHPDYQPTTHTS
DICLLQLNSSATLGPAVGLLGLPRRGARPPRAGTRCKVAGWGSVSDFEELPPGLMEAEVR
VLELDACNSSWKGQLSPAMLCTHSGDRRRRGFCSADSGGPLVCRNRAYGLVSFSGLWCGD
PKTPDVYTQVSAFVTWIRDVIRHGQRGPQPRTTGGRQAL
Download sequence
Identical sequences F1MQA2
ENSBTAP00000039032 ENSBTAP00000039032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]