SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039155 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039155
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily EF-hand 3.95e-30
Family Calmodulin-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039155   Gene: ENSBTAG00000027416   Transcript: ENSBTAT00000039360
Sequence length 135
Comment pep:known_by_projection chromosome:UMD3.1:13:43493944:43494348:-1 gene:ENSBTAG00000027416 transcript:ENSBTAT00000039360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAFSLFHSDSNSTIPMQELGTVLWPLGPNPTKAELQKVVGELDCDGRGPVGFPELLGLMA
WKVKAGDSEDHIWEAFHVFDKDSKILVSTAKRRHAMTWLGKKLNNQEVEEMIRAAHMDAD
GQVNCEEFMHLLVSS
Download sequence
Identical sequences F1MNC1
ENSBTAP00000039155 ENSBTAP00000039155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]