SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039371 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000039371
Domain Number - Region: 59-144
Classification Level Classification E-value
Superfamily EF-hand 0.0523
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039371   Gene: ENSBTAG00000009573   Transcript: ENSBTAT00000039581
Sequence length 326
Comment pep:known_by_projection chromosome:UMD3.1:15:78044073:78254804:1 gene:ENSBTAG00000009573 transcript:ENSBTAT00000039581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPERLALPDYEYLAQRHVLTYVEDAVCQLLENKEDISQYGIARFFTEYFNSVCQGTHI
LFREFSFIQATPHNRASFLRAFWRCFRTVGKNGDLLTMREYHCLLQLLCPDFPLELTQKA
ARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSG
QHRHRPSTGEAGTPEGVEASLFYQCLENLCDRHKYSCPPPALVKEVLSNVQRLTFYGFLV
ALSKHHGINQALGALPDKGDLMHDPAMDEELERLVLRWRPHRSSRQHRAKEPGAFGYQRR
DKLEALQTVPPASAPTPCLYQWEPRE
Download sequence
Identical sequences F1N766
ENSBTAP00000039371 XP_005898986.1.15283 XP_010840667.1.44457 XP_019830378.1.53367 ENSBTAP00000039371 9913.ENSBTAP00000039371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]