SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039412 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039412
Domain Number 1 Region: 91-253
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-32
Family Dual specificity phosphatase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039412   Gene: ENSBTAG00000018479   Transcript: ENSBTAT00000039622
Sequence length 270
Comment pep:known chromosome:UMD3.1:15:78571082:78576838:1 gene:ENSBTAG00000018479 transcript:ENSBTAT00000039622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWVPGAPGGPGDSPGAGPEVATLERPAPAGSSSLGAAAASPPPWPGPRSPASCPAVGGS
PLRRAGWAGMAAGTLLEAGLARVLYYPTLLYTVFRGKMPGRAHRDWYHRIDSTVLLGALP
LRSMTRRLVQDENVRGVITMNEEYETRFLCNSSKEWEKAGVEQLRLSTVDMTGVPTLANL
QKGVQFTIRHQSLGHSVYVHCKAGRSRSATMVAAYLIQVYHWTPEEAIRAITKIRSHIYI
RPGQLEVLKEFHKVTTAGAAKTEIHHTPLT
Download sequence
Identical sequences Q2NKZ7
ENSBTAP00000039412 9913.ENSBTAP00000039412 ENSBTAP00000039412 NP_001069821.1.59421 NP_001069821.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]