SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039445 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039445
Domain Number 1 Region: 26-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-25
Family Calponin-homology domain, CH-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039445   Gene: ENSBTAG00000010677   Transcript: ENSBTAT00000039655
Sequence length 1057
Comment pep:known_by_projection chromosome:UMD3.1:6:61872553:62222095:1 gene:ENSBTAG00000010677 transcript:ENSBTAT00000039655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPVLGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVAVKSLDYS
RKLKNVLVTIYWLGKAANSCASYSGTTLNLKEFEGLLAQMRKETDDIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHR
KLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYVPAPLRKKKAEREEYRKSWST
ATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQLQLINSQLREE
DDKWQDDLARWKSRRRSASQDLIRKEEERKKMEKLLAGEDGTRERRKSIKTYREIVQEKE
RRERELHEAYKNARTQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSPFL
SDPNPMKYLRQQSLPPPKFTATVETTIARPSVLDASMSAGSGSPSKTVSPKAVPMLTPKP
YSQPKNSQEVLKTFKVDGKVTMNGETTHGDEEEKERECPTVALAPSLTKSQMFEGEARVH
GSPVELKQDSNSIEINIKKPSSLPQELTATTEETEANSREDENDGEEAEKGNTEVAPSEP
QLFTTTVTRSSPTVAFVELSPSPQLKNEVPEEKEQKKPENEMSGKVELVLSQKVVKPKSP
EPEATLTFPFLDKMPETNQSPLPNLNSQVDSPSSEKSPVTTPQFKFWAWDPEEERRRQEK
WQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTVSSSSA
DQLSTSSSVTEGSGTVNKMDLENCCEEEQETRQRRPLQEDNSDSLLKTREGDPLEEKGSL
TQEVLTHSENPASEGIYHQLDTEAGAPQCGVNPQLAQDPSQNQQVSNPPMHILEDVKPKT
LPLDKSINHQIESPSERRKSISGKKLCSSCGLPLGKGAAMIIETLNLYFHIQCFKCGICK
GQLGDAVSGTDVRIRNGLLNCNDCYMRSRSAGQPTTL
Download sequence
Identical sequences E1BC91
ENSBTAP00000039445 ENSBTAP00000039445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]