SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039865 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039865
Domain Number 1 Region: 46-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-99
Family G proteins 0.000000275
Further Details:      
 
Domain Number 2 Region: 523-641
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.32e-32
Family Translational machinery components 0.00015
Further Details:      
 
Domain Number 3 Region: 288-315,350-438
Classification Level Classification E-value
Superfamily Translation proteins 2.52e-27
Family Elongation factors 0.00053
Further Details:      
 
Domain Number 4 Region: 446-524
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.08e-22
Family EF-G/eEF-2 domains III and V 0.00019
Further Details:      
 
Domain Number 5 Region: 647-740
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.6e-22
Family EF-G/eEF-2 domains III and V 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039865   Gene: ENSBTAG00000027795   Transcript: ENSBTAT00000040085
Sequence length 756
Comment pep:known_by_projection chromosome:UMD3.1:1:109708534:109758047:-1 gene:ENSBTAG00000027795 transcript:ENSBTAT00000040085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLGAAAAAAVGRGPLPRVPAALGWQGKQANWKICRWCSSGVIPNEKIRNIGISAHIDS
GKTTLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNIN
IIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMRRYNVPFLTFINKLD
RVGSNPARALQQMRSKLSHNAAFVQLPIGLESDFKGIIDLIEERAIYFDGDFGQIVRYGE
IPAEFRAAAADHRQELIECVANSDEQLGEMFLEEKTPSISDLKLAIRRATLNRSFTPVFL
GSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQDDSQEKTKILMNPKRDSSHPFVGLAF
KLEAGRFGQLTYVRNYQGELKKGDNIYNTRTRKKVRVQRLVRMHADMMEDVEEVFAGDIC
ALFGIDCASGDTFTNKDNSGLSMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDP
TFKVHFDTDSKETIVSGMGELHLEIYAQRMEREYGCPCITGKPKVAFRETITAPVPFDFT
HKKQSGGAGQFGKVIGVLEPLDPENYTKLEFSDETFGSNVPKQFVPAVEKGFLDACEKGP
LSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANTALCILEPIMSVEVIAPN
EFQGPVIAGINRRHGVITGQDGIEDYFTLYADVPLNNMFGYSTELRSCTENPQGKGEYTM
EYCRYQPCSPATQEELINKYLEATGQLPVKKGKAKN
Download sequence
Identical sequences E1BEJ3
9913.ENSBTAP00000039865 ENSBTAP00000039865 ENSBTAP00000039865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]