SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039875 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039875
Domain Number 1 Region: 19-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-31
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 
Domain Number 2 Region: 602-680
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.3e-22
Family DIX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039875   Gene: ENSBTAG00000008665   Transcript: ENSBTAT00000040095
Sequence length 685
Comment pep:known_by_projection chromosome:UMD3.1:15:22614860:22659906:1 gene:ENSBTAG00000008665 transcript:ENSBTAT00000040095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTPCLTIFLSLKLLLLSLGIQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLSGVQLSPSNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVEGNLKSIMRLVL
ALAAHFKPGSGRTVSQGRDAGAPLQTHQPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNNSMDEEIENPCWSVRALVQQYEGQQRSPSESSCSSHSLTSPSPIHSAKSESVITQS
EERADFVIIPSEGVENRTEETDSPLPRDWRPGSPRTYLETSWEEQLLEQQEHLEKEMEEA
KKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSIEENQDLKKELL
KYKQEARNLQGIKDALQQRLTQQDASVLQLKQELLRANMDKDELHNQNVDLQRKLEERNR
LLGEYKKELGQKDRLLLQNQAKLEEALRKLSEASYQQVDLERELEHKDVLLAHCMKREAD
EVTNYNNHSSQSNGFLLPAAGKGAASVVHRGSSDLQLVRDALRSLRTSFSGHDPQHHTID
SLEQGISSLMERLHAVETQRKQERRVRGKSPRTQAGSEYRESWPPNSKLPHSQSSPTVSS
ACTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEV
FHDDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences F1MD63
9913.ENSBTAP00000039875 ENSBTAP00000039875 ENSBTAP00000039875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]