SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039959 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039959
Domain Number 1 Region: 14-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-60
Family Eukaryotic proteases 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039959   Gene: ENSBTAG00000027865   Transcript: ENSBTAT00000040181
Sequence length 258
Comment pep:known chromosome:UMD3.1:20:24048537:24059238:-1 gene:ENSBTAG00000027865 transcript:ENSBTAT00000040181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIPFPFSFPPAICLLLIPGVFPVSCEGIIGGNEVAPHTRRYMALIKGLKLCAGALIKEN
WVLTAAHCDLKGNPQVILGAHSTSHKEKLDQVFSIKKAIPYPCFDPQTFEGDLQLLQLEG
KATMTKAVGILQLPRTEDDVKPHTKCHVAGWGSTKKDACQMSNALREANVTVIDRKICND
AQHYNFNPVIDLSMICAGGRKGEDDSCEGDSGSPLICDNVFRGVTSFGKCGNPQKPGIYI
LLTKKHLNWIKKTIAGAI
Download sequence
Identical sequences L8J1B0 Q7YRZ7
ENSBTAP00000039959 ENSBTAP00000039959 9913.ENSBTAP00000039959 NP_001001142.1.59421 NP_001001142.1.76553 XP_005887434.1.15283 XP_019838286.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]