SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040230 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040230
Domain Number 1 Region: 19-163,208-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.79e-37
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040230   Gene: ENSBTAG00000008057   Transcript: ENSBTAT00000042594
Sequence length 331
Comment pep:known chromosome:UMD3.1:5:115583627:115608935:1 gene:ENSBTAG00000008057 transcript:ENSBTAT00000042594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPESLYNLLHLPGKEDPPAEEELSQGEKRKFLPPTSRNNPKFEELQKVLMDWINAELLP
EHIVVRSLEEDIFDGLILHHLFQKLSGLKLDVEEIALTAASQRRKLAAVLESVDQSLQLE
EPQAKWSMESIFNKDLLATLHLLVALAKRFQPDLPLPTNVQVEVITMERTKSGLKSEKSV
EQLTECGADKDQPSKDVFDELFKLAPEKVNAVKEAIVKFVNQELDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPSSPAEMLHNVTLALELLKEEGLLSYPVNPEDIVNK
DAKSTLRVLYSLFRKHKLKESTDGVPQRSPN
Download sequence
Identical sequences A4IFQ5
NP_001077274.1.59421 NP_001077274.1.76553 ENSBTAP00000040230 ENSBTAP00000040230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]