SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040233 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040233
Domain Number 1 Region: 73-135,172-237
Classification Level Classification E-value
Superfamily EF-hand 5.75e-22
Family Calmodulin-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040233   Gene: ENSBTAG00000030189   Transcript: ENSBTAT00000042597
Sequence length 362
Comment pep:known_by_projection chromosome:UMD3.1:5:115127019:115279362:1 gene:ENSBTAG00000030189 transcript:ENSBTAT00000042597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKMAVVPDWHIICPYTRKFTHSRPHSSPCRVYSRSVFQNMFRPSSSTTVANPILSSLDV
KRILFQKITEKGDELKRAFHLLDTANNMTVTKSELRRVITTFLLPLTREQFQDVLAQIPL
TSSGAVPYLVFLSRFGGIDLNINVIKRGGENEMNGCRTLKDLEAQVGEKIFKNIKTVIKA
LMLIDVNTTGLVQPHELRRVLETFCLKMKDEEYKKFAQHYNIDKDAAVDYNVFLKNLGSN
NDLNLKYNMGSQEVLWENQRVKSFKREEPPSSAVSDNIWKNYSLDEIETAFCLELSKCYE
KVEKALSAGDPCTSGYVSLNYLKIVLDTFVYRLPRRIFIQLMKSLLYKIDLLKTKPVFKY
EE
Download sequence
Identical sequences G3X7P6
ENSBTAP00000040233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]