SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040363 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000040363
Domain Number - Region: 46-142
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.00136
Family Glycerophosphoryl diester phosphodiesterase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040363   Gene: ENSBTAG00000007632   Transcript: ENSBTAT00000042733
Sequence length 276
Comment pep:known chromosome:UMD3.1:7:82923270:82957971:1 gene:ENSBTAG00000007632 transcript:ENSBTAT00000042733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATAGGPGSWSENILEYFLRNNQITTEDGAQIVWYHAANHKVQVNEALRSTAHMIEADV
VLPSDGSEHGQPIMAHPPEINSDNTLQEWLAEVIKTNKGIKLDFKSLAAVEPSMMLLENV
KRHLKRPVWINADVLPGPNGNSRVVDAKPFIDTVTSFSPDVTFSLGWTTGWHPEKVNEGY
SWTMVKEMEYICNELNQPVTFPVRAALVRQSCSQLLWLLKQSNRYSLTIWTGKNDSYSTE
DLLFIRDHFDKKRVFYDILEPQNHEFKQAIGIKINL
Download sequence
Identical sequences A5PKK0
NP_001093183.1.59421 NP_001093183.1.76553 ENSBTAP00000040363 ENSBTAP00000040363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]