SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040719 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000040719
Domain Number - Region: 31-111
Classification Level Classification E-value
Superfamily EF-hand 0.00193
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number - Region: 191-344
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0178
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040719   Gene: ENSBTAG00000008614   Transcript: ENSBTAT00000043128
Sequence length 525
Comment pep:known chromosome:UMD3.1:18:56310915:56332899:1 gene:ENSBTAG00000008614 transcript:ENSBTAT00000043128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMPEDQAGGPTAKMYLWDQAEDRSLGTLLSLEEQILNSTFEACDPQRTGTVAVTHLLAY
LEAVTGRGPQDARLQTLACSLDPSGEGPQATVDLDTFLVVMRDWITACQLDGGLELEEET
AFEGALTSQQLPSGCPEVEDPANLESFGGEDPRPELPATADLLSSLEDLELSNRRLAGEN
AKLQRSVETAEEGSARLGEEISALRKQLRSTQQALQLARGVDEELEDLKTLAKSLEEQNR
SLLAQARHTEKEQQRLVAEMETLQEENGKLLAERDGVKRRSEELASEKDILKRQLYECEH
LICQRDAILSERTRHAESLTKTLEEYRATTQELRLEISHLEEQLSQTQEGLDELSEGAQV
RRVDCTNLLPPSLGVELQAIQQRNLQEESAHPQEGREEPSTRLPRREEEDGAEIQVMVDL
PLHPEDSHPGDILGNPPESSPSEPELQQALVPMVKELVPVRRPVWGQLCLWPLHLRRLRV
TRHLLIPAPLLGLLLLLLLSVLLLGQSPPPTWPHLQLCYLQPPPV
Download sequence
Identical sequences Q2T9R2
9913.ENSBTAP00000040719 ENSBTAP00000040719 ENSBTAP00000040719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]