SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040815 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040815
Domain Number 1 Region: 313-431
Classification Level Classification E-value
Superfamily EF-hand 4.56e-31
Family Osteonectin 0.0084
Further Details:      
 
Domain Number 2 Region: 224-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 90-161
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.49e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 43-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000652
Family Ovomucoid domain III-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040815   Gene: ENSBTAG00000030599   Transcript: ENSBTAT00000043227
Sequence length 434
Comment pep:known chromosome:UMD3.1:10:81957653:82102222:1 gene:ENSBTAG00000030599 transcript:ENSBTAT00000043227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPARCARLLTPHLLLALVQLSPAHDHRTTGPRFLISDRDPQCNLHCSRTQPKPVCASDG
RSYESMCEYQRAKCRDPTLAVAHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECTE
DGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPASQGNSGRKDDGSK
PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSEKVHSCDQERQSALEEARQ
NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKS
AEVEDPFKDRELPGCPEGKKLEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
ERVVHWYFSQLDSNSSSDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
LKGCLGVSKEGRLV
Download sequence
Identical sequences A0JNE0
ENSBTAP00000040815 9913.ENSBTAP00000040815 NP_001073239.1.59421 NP_001073239.1.76553 XP_005905813.1.15283 XP_019824694.1.53367 ENSBTAP00000040815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]