SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040995 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000040995
Domain Number - Region: 123-178
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00275
Family Extracellular domain of cell surface receptors 0.069
Further Details:      
 
Domain Number - Region: 20-106
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0375
Family Extracellular domain of cell surface receptors 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040995   Gene: ENSBTAG00000030711   Transcript: ENSBTAT00000043422
Sequence length 230
Comment pep:known_by_projection chromosome:UMD3.1:7:43851496:43862151:-1 gene:ENSBTAG00000030711 transcript:ENSBTAT00000043422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSFLFAGIVVVLTVAAVDTLRCIQCNSLKDSCVAKNATECPSNATTSCTSFSTNFYHGE
HPTWYEDHACSEENCSNTTVESFTVSVSENETFHFESQCCLGEPCNQTSNTTASPHQVGS
GNMECPACYGNNETSCNETRKCYGERCVSIIAEFTNETKTLVLKGCSNVSISTCESLGAG
NQTFRGVTFRKFECGDNFSTTTPLATTDTGSQASFTPLALASILLLSLLL
Download sequence
Identical sequences A2VE33
ENSBTAP00000040995 ENSBTAP00000040995 9913.ENSBTAP00000040995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]