SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041032 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041032
Domain Number 1 Region: 734-910
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-48
Family Chaperone J-domain 0.00000000983
Further Details:      
 
Domain Number 2 Region: 60-216
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.25e-27
Family Dual specificity phosphatase-like 0.00029
Further Details:      
 
Domain Number 3 Region: 224-361
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.25e-26
Family PLC-like (P variant) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041032   Gene: ENSBTAG00000030749   Transcript: ENSBTAT00000043462
Sequence length 910
Comment pep:known_by_projection chromosome:UMD3.1:3:80258491:80375749:-1 gene:ENSBTAG00000030749 transcript:ENSBTAT00000043462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPF
FNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDV
ELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEHQDTLVLGGQAPIDIPPDNPRHFGQG
GFFSTLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHAARKPSK
KQQEPAAPAPPEDVDLLGLEGSAVSKNFSSPAAPPSNSELLSDLFGGGGAAGPVQSGQSG
VDDVFHPSGPTSTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTA
SASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGAWDWHTKPGGFGMGSKSAATSPTGSS
HGTPTHQNKPQTLDPFADLGTLGGSSFASKPSTPTGLGGGFPPLSSPQKASPQPMGGGWQ
QGGGYNWQQTQSKPQSSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFE
DLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV
LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSE
FENQGQKPLY
Download sequence
Identical sequences F1MPP5
ENSBTAP00000041032 ENSBTAP00000041032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]