SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041247 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041247
Domain Number 1 Region: 305-410
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 200-304
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 19-122
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 4 Region: 768-873
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 5 Region: 468-574
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041247   Gene: ENSBTAG00000030885   Transcript: ENSBTAT00000043694
Sequence length 1408
Comment pep:known_by_projection chromosome:UMD3.1:18:62447620:62471100:-1 gene:ENSBTAG00000030885 transcript:ENSBTAT00000043694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLACLLVALMGTQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRE
LGCGGALAAPGGAFFGEGAGPVWLSELACRGGERQLGLCPHRGWKAHICSHEEDAGVVCA
GQRGTDSRDHDDPPSVLDGDPWPGLAGELSPGSEEAPVTPAPRPAGTPQSGSRKKSPRLP
KPAKSTRAPVLTAGAPRQERLRLVSGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACR
ELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVC
TGPAPRLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPGGA
FFGEGAGPILLDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPA
AGSNSSGPRGAPSRSPPPTASQAPQMPGVSVPPAPPTFLQEPGPDAGSPQLRLVAGPSRC
SGRLEVWHAGRWGTVCDDGWDLRDTAVVCRELGCGGPRQSDPTAGRFGWGAGPIWLDDVR
CTGTEAALADCLAAPWGKHNCAHNEDVGVTCAGTPGLDSISDPFSWSWIPGLGRDPDAWL
PGELATKPSARQTPSIPEKTTKAPGKMPKSTKKWVTKNAKRPTTQPPAMPTTKHSRVSGT
QSPPELTSRTTSTLATGASRRPTSEFTTRLTTQAPRRLTSHTTVTRTSRAPRERTSKTVA
TLATQGPRLVTSEATVEPSAELPGQGSPESSTDPAPSPTGAAVPPAGPFRVRLADGPNRC
AGRLEVWHAGQWGTVCDDGWDLRDGMVTCWELGCGRVRPRVGKTHYGPGTGPIWLDDVGC
KGSESSLSDCPARAWGQHNCDHEEDVGLTCTGYADEEDYPPWTWDPTSGEDLAKGTTSAG
VPGHTLSRETTGSPGAPTPATRRLPSTGDKDCREPSRTGDTPSGGVPAKETPTAATPGPP
GTTRSSGHPSLAPRLRGDTGSQRRRWPERRLRPTTARTKPAAPSPPASAAPGPADPPLTS
ASAPPLIRTAASTPEATPDATSAVPPSPVAASRGSAHRTSTSPGLTGPSPDAAAAPAPTS
RLSPTPPPTAPKELTSDPSAPAAATHLSPTSGLTPDPDKAPGRGTSPQPSTVPEPSSSPD
RSTGPHPTTAPYSTMTSHPEPTSHPTTAPYSSMTSHPAATSHPTTAPYSTMTSHPTTALY
STMTSHPAPTSHPTTAPYTIMTSHPASTSHPTTAPPVKPSLHPQLTFTGAPRPSTSPASE
SSLSPAPSMDIPSTENFKAATSQSPEPPPDHLSLGPAPSPSSGPLGPCEAPVPPVRVMAC
EPPALVELVAAVRDVGSQLQRLTQALERDQQDRRALGLGLTQLVEAAQGLGQLGEVVKRL
AEVAWPPTTPVPTTTTPEWEERPLRGDV
Download sequence
Identical sequences F1MLU5
ENSBTAP00000041247 ENSBTAP00000041247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]