SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041340 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041340
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 2.77e-32
Family SH2 domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 153-216
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-23
Family SH3-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041340   Gene: ENSBTAG00000003707   Transcript: ENSBTAT00000043796
Sequence length 217
Comment pep:known chromosome:UMD3.1:19:34796322:34817309:1 gene:ENSBTAG00000003707 transcript:ENSBTAT00000043796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFVPKNYIRLKPHPW
YSGRISRQLAEEILMKRNHQGAFLIRESESSPGEFSVSVNYGDQVQHFKVLRDPSGKYYL
WEEKFNSLNELVAFYRTTTIAKKRQVFLQDEEPLPKPPRACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERLDPSWWRGRLSGRIGFFPRSYVQPVHM
Download sequence
Identical sequences A6QLK6
ENSBTAP00000041340 NP_001095643.1.59421 NP_001095643.1.76553 XP_010814339.1.76553 ENSBTAP00000041340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]