SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041378 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041378
Domain Number 1 Region: 332-436
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-30
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041378   Gene: ENSBTAG00000027524   Transcript: ENSBTAT00000043836
Sequence length 449
Comment pep:known_by_projection chromosome:UMD3.1:15:82114216:82122724:1 gene:ENSBTAG00000027524 transcript:ENSBTAT00000043836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKAGKSSEDGATVPPAAEAPEPAGSGGSAEEETAGPAESAARAGPATAGQQERAPAED
AVSAECQADGLGEVKAESQGEVELQQEDPGQGETAAAHGKTDRKDQTDSEPEGAEGDRET
ASASEEQSADEKEARLGSRETVDASREVQAEPKQASGAQEAEAGGGEAEGPQEEGGKTEE
PQAEAREEAGAPAAQPDSEPGSPDEEQDQGAGAEAEDGAGGPPSSPEGWPESPTEEGGSA
SPEGLSPDTAASEELGPSASDSSPSDVPQSPTEPPPSEEKKKEKAPERRVSAPTRPRGPR
AQNRKAIVDKFGGAAAGPTALFRNTKAAGAAVGGVRNMLLEWCRAMTRSYEHVDIQNFSS
SWGSGMAFCALIHKFFPDAFDYAALDPAQRRHNFTLAFSTAEKLADCAQLLEVDDMVRLA
VPDSKCVYTYIQELYRSLVQKGLVKTKKK
Download sequence
Identical sequences E1BPV6
ENSBTAP00000041378 ENSBTAP00000041378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]