SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041416 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041416
Domain Number 1 Region: 150-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.84e-25
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.4e-23
Family Cell cycle control phosphatase, catalytic domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041416   Gene: ENSBTAG00000030999   Transcript: ENSBTAT00000043880
Sequence length 619
Comment pep:known_by_projection chromosome:UMD3.1:29:50887355:50951170:1 gene:ENSBTAG00000030999 transcript:ENSBTAT00000043880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKRLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQMEAAEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPATLLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKG
ARTRQGGSGLFQSTGFLIPPEFYCSPRGQRAPTNRFFARCLCPWMGRTENYLHKAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
KLLAALQGDGASHPGTPEPLPGPAAPLPPPPPPPTSESAANAASREAAQTGGAEAPGPAP
ATSALQQGLCGLHLSSDRLQDTNRLKRSFSLDIKSAYTPSRRPDDPGPPDPGEAPKLCKL
DSPSGGTLGLPSPSPDSPDAAPDPRPRLRRRPRPPAGSPARSPAQGLGLNFGDATRQTPR
HGLSALSAPGLPGPGQPAGPGGWAPPLDSPGTPSPDGPWCCSPEGAQGAGGARFAPFGRA
GGPGAGGGDLRRRDAARPEARDARTGWPDEPAPETQFKRRSCQMEFEEGMVEGRARGEEL
AALGKQASFSGSVEVIEVS
Download sequence
Identical sequences E1BPA6
ENSBTAP00000041416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]