SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041545 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041545
Domain Number 1 Region: 290-639
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.53e-128
Family Mammalian PLC 0.000000119
Further Details:      
 
Domain Number 2 Region: 133-289
Classification Level Classification E-value
Superfamily EF-hand 1.12e-47
Family EF-hand modules in multidomain proteins 0.00039
Further Details:      
 
Domain Number 3 Region: 657-782
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-30
Family PLC-like (P variant) 0.00012
Further Details:      
 
Domain Number 4 Region: 11-123
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-28
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041545   Gene: ENSBTAG00000003809   Transcript: ENSBTAT00000044026
Sequence length 791
Comment pep:known_by_projection chromosome:UMD3.1:2:107298620:107321320:1 gene:ENSBTAG00000003809 transcript:ENSBTAT00000044026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYLLQGRLPINQDLLLMQKGTMMRKVRSKSWKKLRFFRLQDDGMTVWHARQAGGRAKPS
FSISDVDTVREGHESELLRNLAEEFPLEQGFTIVFHGRRSNLDLVANSVQEAQTWMQGLQ
LLVGFVTNMDQQERLDQWLSDWFQRGDKNQDGRMSFGEVQRLLHLMNVEMDQEYAFQLFQ
TADTSQSGTLEGEEFVEFYKSLTQRPEVQELFEKFSSDGQKLTLLEFVDFLQEEQKEGER
ASDLALELIDRYEPSESGKLRHVLSMDGFLGYLCSKDGDIFNPTCHPLYQDMTQPLNHYY
INSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVAAIGQYAFQTSDYPVILSLENHCSWEQQEIIVRHLTEILGDQLLTTALDGQPPTQL
PSPEDLRGKILVKGKKLMLEEEEEEPEAELEAEQEARLDLEAQLESEPQDLSPRSEDKKK
VVMCPLLCRPLCCQIMAQAPISKPGLLLFPKQKPKAILCPALSALVVYLKAVTFYSFTHS
REHYHFYETSSFSETKAKSLIKEAGDEFVQHNAWQLSRVYPSGLRTDSSNYNPQEFWNAG
CQMVAMNMQTAGLEMDLCDGLFRQNAGCGYVLKPDFLRDAQSSFHPERPISPFKAQTLII
QVISGQQLPKVDNTKEQSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNPYWGQTLCFRI
LVPELALLRFVVKDYDWKSRNDFIGQYTLPWSCMQQGYRHIHLLSKDGLSLHPASIFVHI
CTQEVSEEAES
Download sequence
Identical sequences F1MKT3
ENSBTAP00000041545 9913.ENSBTAP00000041545 ENSBTAP00000041545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]