SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041719 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041719
Domain Number 1 Region: 64-209
Classification Level Classification E-value
Superfamily EF-hand 2.88e-36
Family Calmodulin-like 0.000000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041719   Gene: ENSBTAG00000031217   Transcript: ENSBTAT00000044205
Sequence length 211
Comment pep:known chromosome:UMD3.1:5:57489469:57492173:-1 gene:ENSBTAG00000031217 transcript:ENSBTAT00000044205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKDVPVKKPVGPPAAPKPAAKPAVGPPPSRVELPSLIPVILEKPAKIQEPPIDLSKV
VIEFNKDQLEEFKEAFELYDRVGDGKIQFSQCGDVMRALGQNPTNAEVLRVLGYPKSDEL
KSRRVDFETFLPMLQAVAKLPDRGSYQDYLEGLRVFDKEQNGKVMGAELRHVLTTLGERM
TEEEVESVLAGHEDSSGCINYEAFLKHILSV
Download sequence
Identical sequences L8I5G7 Q148H2
9913.ENSBTAP00000041719 NP_001069181.1.59421 NP_001069181.1.76553 XP_005206636.1.76553 XP_005903487.1.15283 XP_010837516.1.44457 XP_019816610.1.53367 ENSBTAP00000041719 ENSBTAP00000041719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]