SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041742 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041742
Domain Number 1 Region: 33-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-43
Family Eukaryotic proteases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041742   Gene: ENSBTAG00000031236   Transcript: ENSBTAT00000044230
Sequence length 243
Comment pep:known chromosome:UMD3.1:4:106342661:106350335:-1 gene:ENSBTAG00000031236 transcript:ENSBTAT00000044230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCCVFFMLMSTAGVILAADSNTEKRNEVDFTIPYMVYLQSFPEPCVGTLIHPQWVLTAA
HCPSPVKIRLGIYQPNIKNKHEQTQSYSMTVPYPDFNSEYLSNDLMMIKLSEAAKVTTQV
GTIAIAMEPLSLNESCFIPTWTWSKYKNLSDPDILTWINQYTRPYDECQNMQDERMAANV
LCVGQPLKTLSDAKEVSAAPAICGGRVHGILSWAKGSVTLGNEGFFTEISSYSRWIMSII
ESY
Download sequence
Identical sequences F1MDE9
ENSBTAP00000041742 ENSBTAP00000041742 XP_010853289.1.44457 XP_010853290.1.44457 XP_019815159.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]