SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041859 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041859
Domain Number 1 Region: 284-504
Classification Level Classification E-value
Superfamily SIS domain 0.000000526
Family mono-SIS domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000041859
Domain Number - Region: 68-164
Classification Level Classification E-value
Superfamily SIS domain 0.000934
Family mono-SIS domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041859   Gene: ENSBTAG00000031302   Transcript: ENSBTAT00000044354
Sequence length 505
Comment pep:known_by_projection chromosome:UMD3.1:11:72154947:72176344:-1 gene:ENSBTAG00000031302 transcript:ENSBTAT00000044354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKWFQLVTETPEPGKWESSGYEAALPITAKSNLTRDLDKADAEQMQCDAELFQEEGQ
VMPTYQRLYNESTLTTMEQVAEKVQKVLKEPGVGGGLVVLSGGGTSGRMAFLMSVSFNQL
MKETYLNAGGDRSVVASREGTEYSALDRIEELKKVAAGKKRVIVTGASVGLLAPFLAGQM
NYCVDNPDFLPVLVGFNPLSMASSERTEGSLQRIEEVIAEQMQKLQEKQEAFVLNPATRP
EGLSDSFWMKSRSTTNILLEALLPAAHKTVDHCRWGIAASPRCLLEILQTFKWASQVTYG
QSPKITTLMKQTHTQPGEKGQVYLVGWQTLGIIAIMDGVECMHTFGADDFRDVHGSLIAD
RSGMFNLAAELINQGPHFSFSQEDFLTSILPSLTETDTVLFIFTLDDSLTEVQTLVEQTP
NIQALAHSTMGQSLPIPLKKPFPSIISITWPLLFFKYEGNFIQKFQHELSTKWVLNTMSI
GAHVLLGQILQNHMLDLLIHNSKLF
Download sequence
Identical sequences E1BK20
ENSBTAP00000041859 ENSBTAP00000041859 9913.ENSBTAP00000041859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]