SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042177 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042177
Domain Number 1 Region: 301-421
Classification Level Classification E-value
Superfamily EF-hand 2.16e-32
Family Osteonectin 0.0098
Further Details:      
 
Domain Number 2 Region: 210-282
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.55e-21
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 74-156
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.07e-19
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 4 Region: 39-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000679
Family Ovomucoid domain III-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042177   Gene: ENSBTAG00000013176   Transcript: ENSBTAT00000044700
Sequence length 444
Comment pep:known_by_projection chromosome:UMD3.1:9:104268693:104380527:1 gene:ENSBTAG00000013176 transcript:ENSBTAT00000044700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQLLCWVPLRALAPPPLSSQRFSLLEFLRVDQDKDKDCSLDCGGSAQKPLCASDGRTFL
SRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARRELQQVFIPECSDDGTYSQ
VQCHSYTGYCWCVTPNGRPIGGTAVAHKTPRCPGSINEKVPQREGTGKTDDASAPALETQ
PQGDEEDVASRYPTLWTEQVKSRQNKTNKNSVSSCDQEQQSALEEARQPKNDNVVIPECA
HGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPVRTRDLYKSRQL
QGCPGAKKREFLTSVLDALSTDMVHAVSDPSSPGRLSEPDPSHTLEERVVHWYFKLLDKN
NSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISLQELMGCLGATREEVKA
DTRKRHTPRGNAESTSNRQPRKKQ
Download sequence
Identical sequences F1N126
ENSBTAP00000042177 ENSBTAP00000042177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]