SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042196 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042196
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.33e-61
Family Eukaryotic proteases 0.00056
Further Details:      
 
Domain Number 2 Region: 293-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-51
Family Eukaryotic proteases 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042196   Gene: ENSBTAG00000031551   Transcript: ENSBTAT00000044725
Sequence length 553
Comment pep:known_by_projection chromosome:UMD3.1:25:27450356:27455369:-1 gene:ENSBTAG00000031551 transcript:ENSBTAT00000044725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSWRLKLFILGAVVLTEGLQAAQRACGQRGPGPPEPQEGNTMPGEWPWQASVRRQGIH
ICSGSLVADIWVLTAAHCFEKEAMTELNSWSVVLGSLQHEGLSPGAEEVGVTALQLPRAY
NHYSQGSDLALLRLAHPIAHTPLCLPRPAHRFPFGTSCWATGWYQHTNDAPRTLRNLRLR
LISRPTCNCLYNRLHQRSLASPARPGMLCGGPQPGMQGPCQGDSGGPVLCREPDGHWVQA
GIISFASSCAREDTPVLLTDMAAHSSWLQARAQGAAFLTQNPETPEISDEDSCVACGSLR
REGPQAGAPSPWPWDARLKHQGKLACGGALVSEEVVLTAAHCFIGRQTPEEWTVGLGVGP
EESGLKQVILHGAYTHPEGGYDVALLLLAQPVTLGPSLRPLCLPYSDHRLPDGERGWVLG
LARQGADTGSPQTVPVTLLGPRACSRLHAALGSILPGMVCTSVVGEPPSCEGLSGAPLVH
EVRGTWFLAGLHSFGDACQGPARPAVFAALPTYENWVSSLDWQVYFAEEPEPEPEPEPEP
GSCTANMSQPANC
Download sequence
Identical sequences F1N116
ENSBTAP00000042196 ENSBTAP00000042196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]