SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042361 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042361
Domain Number 1 Region: 18-165
Classification Level Classification E-value
Superfamily EF-hand 1.67e-41
Family Calmodulin-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042361   Gene: ENSBTAG00000020049   Transcript: ENSBTAT00000044919
Sequence length 167
Comment pep:known chromosome:UMD3.1:17:65154254:65170682:1 gene:ENSBTAG00000020049 transcript:ENSBTAT00000044919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCVKSPLRNLSRKDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTE
MELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEIS
TSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences A0A2I2Z4X3 A0A2I3HXG2 A0A2I3NAN5 A0A2I3RNX9 A0A2J8XJZ6 A0A2K5CVT7 A0A2K5ILX3 A0A2K5KMG9 A0A2K5S7Y7 A0A2K5UTM3 A0A2K5XQE2 A0A2K6ETU3 A0A2K6KMA9 A0A2K6RJV9 A0A2K6V8C5 F7FYZ7
ENSBTAP00000042361 ENSRNOP00000033685 NP_001028847.1.100692 NP_001028847.1.4139 NP_001297644.1.92730 XP_003280335.1.23891 XP_004281462.1.21590 XP_004396715.1.74151 XP_004591955.1.84141 XP_004664183.1.11716 XP_006053012.1.26621 XP_006908682.1.64745 XP_007448259.1.90284 XP_007607165.1.28591 XP_007642309.1.69978 XP_007936416.1.48129 XP_008003151.1.81039 XP_010366605.1.97406 XP_011354186.1.92234 XP_011803937.1.43180 XP_011819858.1.47321 XP_012505621.1.63892 XP_012660674.1.62490 XP_019665142.1.58354 XP_021559195.1.83697 ENSMUSP00000107740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]