SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042493 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042493
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Nudix 1.76e-26
Family MutT-like 0.000000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042493   Gene: ENSBTAG00000031793   Transcript: ENSBTAT00000045076
Sequence length 147
Comment pep:known chromosome:UMD3.1:8:77063061:77073920:1 gene:ENSBTAG00000031793 transcript:ENSBTAT00000045076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRACGLIIFRRRLIPKVDNTAIEFLLLQASDGIHHWTPPKGHVEPGESDLETALRETQ
EEAGIEAGQLTIIEGFRRELSYVARAKPKIVIYWLAEVKDCDVEVRLSREHQAYRWLELE
DACQLAQFEEMKAALQEGHQFLCSTAT
Download sequence
Identical sequences Q29RJ1
NP_001070570.1.59421 NP_001070570.1.76553 XP_010838410.1.44457 XP_010838411.1.44457 XP_019821998.1.53367 9913.ENSBTAP00000042493 ENSBTAP00000042493 ENSBTAP00000042493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]