SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042825 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042825
Domain Number 1 Region: 501-791
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.9e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000811
Further Details:      
 
Domain Number 2 Region: 93-239
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 1-95
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-32
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 4 Region: 388-482
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-21
Family PDZ domain 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042825   Gene: ENSBTAG00000020855   Transcript: ENSBTAT00000045437
Sequence length 804
Comment pep:known chromosome:UMD3.1:2:72049607:72146322:1 gene:ENSBTAG00000020855 transcript:ENSBTAT00000045437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSELGDYNQSENLSGYLSDYSFIPNQPQ
DFEKEITKLHQQHIGLSPAEAEFSYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGGIL
IYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKACV
EHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPSKP
LARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLVGH
MVHASPSEAFGNHHSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWSQIHYSH
SQQDLENHVNETFDVPSSPEKSTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGCDQKMPV
IVSRVAPGTPADLCVPRLNEGDQVVLINGQDIAEHTHDQVVLLIKASCERHSGELVLLVR
PNAVYDVVEEKLENEPDFQYIPEKAPLDSVQQDDHSLRESMIQLAEGLITGTVLTQFDQL
YRKKPGMTMCCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSRIINQ
YIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVT
CHSEEGNTAYVFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKRA
GKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQYR
FVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences E1BJR7
ENSBTAP00000042825 ENSBTAP00000042825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]