SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042854 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042854
Domain Number 1 Region: 147-448
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-121
Family Transglutaminase core 0.0000000136
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.85e-43
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 496-593
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-27
Family Transglutaminase, two C-terminal domains 0.00024
Further Details:      
 
Domain Number 4 Region: 437-494
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000128
Family Transglutaminase, two C-terminal domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042854   Gene: ENSBTAG00000032059   Transcript: ENSBTAT00000045466
Sequence length 595
Comment pep:known_by_projection chromosome:UMD3.1:21:55515505:55549383:-1 gene:ENSBTAG00000032059 transcript:ENSBTAT00000045466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGLEVALTDLQSSWNNVQHHTDEISSSRLLVRRGQAFNITLYFRNRAFQPGLDNIIFV
TETGPLPDLSKGTRAVFSLEGHPGSSPWIASLQTIGANSLEVSLCAPPMAAVGRYLLKVH
IKSLQGPVTAYKLGEFILLFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVSAMINSNDDNGVLNG
NWGENYSDGTNPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDT
STVGNFISTKSIQSDERDDITENYKYREAKTYPCKITYSQYSQYLSTDKLIRISALGEEK
NSPEKILVKKIITLAYPSIVINVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLF
RRQQRVLIGVLKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYTNVYIGL
Download sequence
Identical sequences F1MVK3
ENSBTAP00000042854 ENSBTAP00000042854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]