SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042857 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042857
Domain Number 1 Region: 39-308
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.19e-61
Family Glycerophosphoryl diester phosphodiesterase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042857   Gene: ENSBTAG00000016155   Transcript: ENSBTAT00000045469
Sequence length 318
Comment pep:known_by_projection chromosome:UMD3.1:25:26444489:26449827:1 gene:ENSBTAG00000016155 transcript:ENSBTAT00000045469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLLYYALPALGSYVMLSFFFLRRPRLLHTPWVPAFRPRLGAHRGGSGERLENTMEAME
NSMAQRADFLELDCQLTRDGVVVVSHDKNLSRQTGVNRDVGSLNFEDLPLLKEELEVYFS
PGHFARGADRHMMRLEDLFRRFPRTPMSVEVKERNEELIHKIACLVRHYDRNEITIWASE
KSSIMKKCKAANPEMPTSFTLSRGFWVLLFYYLGLLPFISIPEKFFMCFLPTIINRTYFP
FSHPGLNQLAAVVAKWLIMRKSLIQHLQQRGVQVVFWCLNEESDFEAAFNLGATGVITDY
PTALRCYLDSRGPPALAS
Download sequence
Identical sequences E1BJ80 L8IMG7
ENSBTAP00000042857 9913.ENSBTAP00000042857 ENSBTAP00000042857 NP_001070458.2.59421 NP_001070458.2.76553 XP_005894540.1.15283 XP_019843642.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]