SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043063 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043063
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Globin-like 2.02e-52
Family Globins 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043063   Gene: ENSBTAG00000038748   Transcript: ENSBTAT00000045694
Sequence length 145
Comment pep:known chromosome:UMD3.1:15:49022978:49024619:1 gene:ENSBTAG00000038748 transcript:ENSBTAT00000045694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVK
AHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKE
FTPVLQADFQKVVAGVANALAHRYH
Download sequence
Identical sequences D4QBB4 D4QBB8 D4QBE6 D4QBF3 P02070
ENSBTAP00000043063 2qssB 9913.ENSBTAP00000043063 1fsx_B 1fsx_D 1g08_B 1g08_D 1g09_B 1g09_D 1g0a_B 1g0a_D 1hda_B 1hda_D 2qsp_B 2qsp_D 2qss_B 2qss_D 3ciu_B 3ciu_D 3pi8_B 3pi8_D 3pi9_B 3pi9_D 3pia_B 3pia_D 000050719|e1fsxD1|106.1.1.2|D:1-145 000050720|e1g09D1|106.1.1.2|D:1-145 000050726|e1hdaB1|106.1.1.2|B:1-145 000050750|e1fsxB1|106.1.1.2|B:1-145 000050769|e2qssB1|106.1.1.2|B:1-145 000050803|e3ciuD1|106.1.1.2|D:1-145 000050905|e3ciuB1|106.1.1.2|B:1-145 000050910|e1hdaD1|106.1.1.2|D:1-145 000050915|e1g08D1|106.1.1.2|D:1-145 000050958|e2qspB1|106.1.1.2|B:1-145 000050967|e2qssD1|106.1.1.2|D:1-145 000050987|e2qspD1|106.1.1.2|D:1-145 000051039|e1g08B1|106.1.1.2|B:1-145 000051043|e1g0aD1|106.1.1.2|D:1-145 000051085|e1g09B1|106.1.1.2|B:1-145 000051092|e1g0aB1|106.1.1.2|B:1-145 000406405|e3pi8B1|106.1.1.2|B:1-145 000406406|e3pi8D1|106.1.1.2|D:1-145 000406409|e3pi9B1|106.1.1.2|B:1-145 000406410|e3pi9D1|106.1.1.2|D:1-145 000406413|e3piaB1|106.1.1.2|B:1-145 000406414|e3piaD1|106.1.1.2|D:1-145 cath|current|1fsxB00/202-346 cath|current|1fsxD00/602-746 cath|current|1g08B00/2-146 cath|current|1g08D00/2-146 cath|current|1g09B00/2-146 cath|current|1g09D00/2-146 cath|current|1g0aB00/2-146 cath|current|1g0aD00/2-146 cath|current|1hdaB00/2-146 cath|current|1hdaD00/2-146 cath|current|2qspB00/1-145 cath|current|2qspD00/1-145 cath|current|2qssB00/1-145 cath|current|2qssD00/1-145 cath|current|3ciuB00/2-146 cath|current|3ciuD00/2-146 cath|current|3pi8B00/2-146 cath|current|3pi8D00/2-146 cath|current|3pi9B00/2-146 cath|current|3pi9D00/2-146 cath|current|3piaB00/2-146 cath|current|3piaD00/2-146 d1fsxb_ d1fsxd_ d1g08b_ d1g08d_ d1g09b_ d1g09d_ d1g0ab_ d1g0ad_ d1hdab_ d1hdad_ d2qspb_ d2qspd_ d2qssb_ d2qssd_ d3ciub1 d3ciud1 d3pi8b_ d3pi8d_ d3pi9b_ d3pi9d_ d3piab_ d3piad_ ENSBTAP00000043063 NP_776342.1.59421 NP_776342.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]