SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043168 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043168
Domain Number 1 Region: 138-407
Classification Level Classification E-value
Superfamily EndoU-like 1.23e-95
Family Eukaryotic EndoU ribonuclease 0.00000542
Further Details:      
 
Domain Number 2 Region: 21-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000301
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 90-129
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000034
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043168   Gene: ENSBTAG00000012275   Transcript: ENSBTAT00000045807
Sequence length 413
Comment pep:known chromosome:UMD3.1:5:32731732:32748812:1 gene:ENSBTAG00000012275 transcript:ENSBTAT00000045807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACVPLTVAILCGLAWAGKRESCASRCNERFDRDAVCQCDRRCPQHGDCCEDYEQLCTA
EENPKEPELFLELEEETEGAPASSLYLAPNSCQGRCLEAFDKHHSCHCNARCPEFGNCCE
DFESLCGHEGFSHSSDAITKEELQSVSEKIYRADTNKARKEDIVLNSQNCISPSETRDQV
DRCPEPLFTYVNEKLFSKPTYSAFLNLLNNYQRATGRGEHFTAQELAEQDTFLREIMKTA
VMKELYGFLHQQNRYSSEQEFVSDLKNMWFGLYSRSKEERDSSGFEHVFSGEVKKGKVTG
FHNWIRFYMQEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEF
ALYSLCFIARPGKVCQLSLGGHPLAIQTYTWNKSTYGNGKKYIATAYVVSSTH
Download sequence
Identical sequences A6QLQ8 L8I1Z4
9913.ENSBTAP00000043168 NP_001095560.1.59421 NP_001095560.1.76553 XP_005905512.1.15283 XP_019816281.1.53367 ENSBTAP00000043168 ENSBTAP00000043168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]