SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043972 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043972
Domain Number 1 Region: 112-209
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-24
Family SH2 domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043972   Gene: ENSBTAG00000024470   Transcript: ENSBTAT00000046702
Sequence length 418
Comment pep:known chromosome:UMD3.1:3:14075266:14085162:1 gene:ENSBTAG00000024470 transcript:ENSBTAT00000046702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPLAQICPQGSREAPAITFSTFQPLGLNRRSCQGPGLLLGPRLQAPEEAWPSPRGPAG
QAVAPLQVPAAACNPKDVGKEEVPREEALFLQAETRAWFQKTQAHELLQHGAAPIWFHGF
ITRREAERLLETKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLGDGRHVVLGEDSA
HARLQDLLLHYTACPLSPYGETLTEPLARQTPEPAGLSLRTEESDFGSKSQDSPFQYSPI
LKKERSIAPTQRDGSGEPKQSSQSPRPKPPIPAKPQLQPEVYTSPAPRPRPALPPKPSNP
IYNEPDEPIDFYAMGRGSPGEAPSNIYAEVEVREPDSRSEDPQCILRHEVLRKCQSRPVL
GSQNPGGQQLHSENSVAEQGPTVPHQPLPRWGHTLPHNLSRQVLQDRGQAWLPLGPPQ
Download sequence
Identical sequences A7Z041
ENSBTAP00000043972 ENSBTAP00000043972 9913.ENSBTAP00000043972 NP_001098871.1.59421 NP_001098871.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]