SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043999 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043999
Domain Number 1 Region: 959-1086,1118-1323
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-69
Family p120GAP domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 26-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-38
Family Calponin-homology domain, CH-domain 0.0000206
Further Details:      
 
Domain Number 3 Region: 1539-1636
Classification Level Classification E-value
Superfamily RGC domain-like 4.18e-30
Family RGC domain 0.0000104
Further Details:      
 
Domain Number 4 Region: 673-702
Classification Level Classification E-value
Superfamily WW domain 0.000024
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043999   Gene: ENSBTAG00000006882   Transcript: ENSBTAT00000046733
Sequence length 1636
Comment pep:known chromosome:UMD3.1:3:14306401:14346150:1 gene:ENSBTAG00000006882 transcript:ENSBTAT00000046733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRGAGPGRAIYERLTAEEMDEQRRQNIAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDAEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYDLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVRDTLAALQNPNALLENL
REPLAAIYQELLAQAKMEKAANARNCFLQNDGESQDIYDCYLTQAEIQGNINHVNVHGAL
EVVDDALERQSPEALLEALQDPVLTLQGVRRDFADWYLEQLSSDREQKAQELGLMELLEK
EEVQAGVAAANIKGDQEQAMLRAVQRINKAIRRGVAADTVKELMCPEAQLPPVYPFASAV
YQQELAVLQQQQQGELAQEELFVAVEMLSAVVLINRALEAKDASGFWSSLVNPATGLAEV
DRENAQRYFDALVKLRQICGVDGAFLSWNDLQAAVSQVNAQVQEETDQILAVSLINEALD
QDNPEKTLSSLLLPAASLDDISLPVAPRYHLLLMAAKRRKAQVTGDPEAVLWLEEIRQEV
VRANQDTDAAQRMALGVAAINQAIKEGKAAQTERVLRNPSVGLRGVVPDCADGYQRLLED
AMAKKQRPGDTALWVQHAMKDGTAYYFHLQTFQGTWERPPGCHLNTSHLTWKEIQSAVTK
VTTAHDRQQLWKANVGFIIRLQARLRGFLVRQKFAKHSHFLRTWLPAVVKIQAHWRGYRQ
RKIYLKRLQYLKANTNAVIKIQAWARMWAARRRYRKRLGYFQKNVNSIVKIQAFFRARKA
RDDYRMLGKVPGFPPLSVVRQVVHLLNQSQEDFLAEAELLKLQEEVVRKIRSNQQLEQDL
NLMDIKIGLLVKNRITLQEVVSHCKKLTKKNKEQLSDMMVLDKQKGLKSLSKEKRQKLEA
YQHLFYLLQTQPSYLAKLIFQMPQNKTTKFMESVIFSLYNYASNSREAYLLLQLFKAALQ
EEIKSKVEQPQDMVTGNPTVVRLVVRFYRNGRGQSALREILGKVIQDVLEDKMLSVHTDP
VHLYKSWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDISLRNLLTVTDKFLAAIMS
SVDQIPYGMRYVAKVLKTTLAEKFPDATESEIHKVVGNLLYYRFLNPAVVAPDAFDIVAM
AAGGALAAPQRHALGAVAQVLQHAAAGKAFSRESQHLRVLNDYLEETHLKFRRFICRACQ
VLEPEERFAMDEYSDMVAVAKPMVYITMGELVNTHRLLLEHQDWIAPDHRDPLHELLEDL
GELPTVPDLIGENVAMDGNVDLSKLEVSLTLTNKFEGLETDADDTNSQSLLLSTKQMLAD
IMQFHSGDSLQDILSLSASREEEAAHKRLMCRRQACEAQTPEPLRRHRSLTAHSLLPLAE
KQRRVLRNLRRLEGLGLVSARDGYQGLVDELAKDIRNQRKHRQRRKAELLKLQATLQGLS
TKTTFYEEQGDYYSQYIRACLDHLAPSSKSSGKGKKQVSLHYTAAQLLEKGVLVEIEDLP
TSHFRNVIFDITPGEEAGRFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKV
NVNLLIFLLNKKFLRK
Download sequence
Identical sequences E1B946
ENSBTAP00000043999 ENSBTAP00000043999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]