SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044096 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044096
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily EF-hand 5.39e-23
Family S100 proteins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044096   Gene: ENSBTAG00000006505   Transcript: ENSBTAT00000046849
Sequence length 147
Comment pep:known_by_projection chromosome:UMD3.1:3:17176310:17179005:-1 gene:ENSBTAG00000006505 transcript:ENSBTAT00000046849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAIN
EIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGPGHRHGPGYGKGSPDQGSH
DQGSHGHGHGHSHGGHGHSHGGHGHSH
Download sequence
Identical sequences E1BLI9
ENSBTAP00000044096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]